EMG1 Rabbit Polyclonal Antibody

CAT#: TA345953

Rabbit Polyclonal Anti-EMG1 Antibody

Product Images

Host: Rabbit; Target Name: EMG1; Sample Tissue: THP-1 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-EMG1 antibody is: synthetic peptide directed towards the C-terminal region of Human EMG1. Synthetic peptide located within the following region: VSDVRELVPSSDPIVFVVGAFAHGKVSVEYTEKMVSISNYPLSAALTCAK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: EMG1, N1-specific pseudouridine methyltransferase
• Database Link:
  NP_006322
  Entrez Gene 10436 Human
  UniProt ID Q92979
• Background: EMG1 involved in 40S ribosomal subunit biogenesis. It seems to play a role a methylation reaction in pre-rRNA processing.
• Synonyms: C2F; Grcc2f; NEP1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%; Zebrafish: 79%