EMG1 (NM_006331) Human Recombinant Protein

CAT#: TP308885

Recombinant protein of human EMG1 nucleolar protein homolog (S. cerevisiae) (EMG1)

Product Images

Coomassie blue staining of purified EMG1 protein (Cat# TP308885). The protein was produced from HEK293T cells transfected with EMG1 cDNA clone (Cat# RC208885) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC208885 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAPSDGFKPRERSGGEQAQDWDALPPKRPRLGAGNKIGGRRLIVVLEGASLETVKVGKTYELLNCDKHK
  SILLKNGRDPGEARPDITHQSLLMLMDSPLNRAGLLQVYIHTQKNVLIEVNPQTRIPRTFDRFCGLMVQL
  LHKLSVRAADGPQKLLKVIKNPVSDHFPVGCMKVGTSFSIPVVSDVRELVPSSDPIVFVVGAFAHGKVSV
  EYTEKMVSISNYPLSAALTCAKLTTAFEEVWGVI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 26.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006322
• Locus ID: 10436
• UniProt ID: Q92979
• Cytogenetics: 12p13.31
• Refseq Size: 1072
• Refseq ORF: 732
• Synonyms: C2F; Grcc2f; NEP1
• Summary: This gene encodes an essential, conserved eukaryotic protein that methylates pseudouridine in 18S rRNA. The related protein in yeast is a component of the small subunit processome and is essential for biogenesis of the ribosomal 40S subunit. A mutation in this gene has been associated with Bowen-Conradi syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]