EMG1 (NM_006331) Human Recombinant Protein
CAT#: TP308885
Recombinant protein of human EMG1 nucleolar protein homolog (S. cerevisiae) (EMG1)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208885 protein sequence
Red=Cloning site Green=Tags(s) MAAPSDGFKPRERSGGEQAQDWDALPPKRPRLGAGNKIGGRRLIVVLEGASLETVKVGKTYELLNCDKHK SILLKNGRDPGEARPDITHQSLLMLMDSPLNRAGLLQVYIHTQKNVLIEVNPQTRIPRTFDRFCGLMVQL LHKLSVRAADGPQKLLKVIKNPVSDHFPVGCMKVGTSFSIPVVSDVRELVPSSDPIVFVVGAFAHGKVSV EYTEKMVSISNYPLSAALTCAKLTTAFEEVWGVI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006322 |
Locus ID | 10436 |
UniProt ID | Q92979 |
Cytogenetics | 12p13.31 |
Refseq Size | 1072 |
Refseq ORF | 732 |
Synonyms | C2F; Grcc2f; NEP1 |
Summary | This gene encodes an essential, conserved eukaryotic protein that methylates pseudouridine in 18S rRNA. The related protein in yeast is a component of the small subunit processome and is essential for biogenesis of the ribosomal 40S subunit. A mutation in this gene has been associated with Bowen-Conradi syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401906 | EMG1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401906 | Transient overexpression lysate of EMG1 nucleolar protein homolog (S. cerevisiae) (EMG1) |
USD 396.00 |
|
PH308885 | EMG1 MS Standard C13 and N15-labeled recombinant protein (NP_006322) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review