EMG1 (NM_006331) Human Mass Spec Standard

CAT#: PH308885

EMG1 MS Standard C13 and N15-labeled recombinant protein (NP_006322)

Product Images

Coomassie blue staining of purified EMG1 protein (Cat# TP308885). The protein was produced from HEK293T cells transfected with EMG1 cDNA clone (Cat# RC208885) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208885
• Predicted MW: 26.7 kDa
• Protein Sequence:
  Sequence Link

  >RC208885 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAPSDGFKPRERSGGEQAQDWDALPPKRPRLGAGNKIGGRRLIVVLEGASLETVKVGKTYELLNCDKHK
  SILLKNGRDPGEARPDITHQSLLMLMDSPLNRAGLLQVYIHTQKNVLIEVNPQTRIPRTFDRFCGLMVQL
  LHKLSVRAADGPQKLLKVIKNPVSDHFPVGCMKVGTSFSIPVVSDVRELVPSSDPIVFVVGAFAHGKVSV
  EYTEKMVSISNYPLSAALTCAKLTTAFEEVWGVI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006322
• RefSeq Size: 1072
• RefSeq ORF: 732
• Synonyms: C2F; Grcc2f; NEP1
• Locus ID: 10436
• UniProt ID: Q92979
• Cytogenetics: 12p13.31
• Summary: This gene encodes an essential, conserved eukaryotic protein that methylates pseudouridine in 18S rRNA. The related protein in yeast is a component of the small subunit processome and is essential for biogenesis of the ribosomal 40S subunit. A mutation in this gene has been associated with Bowen-Conradi syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]