Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-EXD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EXD2 Antibody is: synthetic peptide directed towards the N-terminal region of Human EXD2. Synthetic peptide located within the following region: SNWDAETLTEDQVIYAARDAQISVALFLHLLGYPFSRNSPGEKNDDHSSW |
Rabbit Polyclonal Anti-EXD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EXD2 Antibody is: synthetic peptide directed towards the middle region of Human EXD2. Synthetic peptide located within the following region: NGEATESQQKPRNKKSKMDGMVPGNHQGRDPRKHKRKPLGVGYSARKSPL |
EXD2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human EXD2 |
EXD2 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human EXD2 |
Active filters
Target Symbol
- EXD2