Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-EIF4B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EIF4B antibody: synthetic peptide directed towards the C terminal of human EIF4B. Synthetic peptide located within the following region: NPPARSQSSDTEQQSPTSGGGKVAPAQPSEEGPGRKDENKVDGMNAPKGQ |
Rabbit Polyclonal Anti-EIF4B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EIF4B antibody: synthetic peptide directed towards the middle region of human EIF4B. Synthetic peptide located within the following region: QTGNSSRGPGDGGNRDHWKESDRKDGKKDQDSRSAPEPKKPEENPASKFS |
Rabbit Polyclonal Anti-eIF4B Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-eIF4B Antibody: A synthesized peptide derived from human eIF4B |
Rabbit Polyclonal Anti-eIF4B (Phospho-Ser422) Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-eIF4B (Phospho-Ser422) Antibody: A synthesized peptide derived from human eIF4B (Phospho-Ser422) |
| Modifications | Phospho-specific |
EIF4B rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human EIF4B |
Rabbit Polyclonal Anti-EIF4B Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Eif4b antibody is: synthetic peptide directed towards the C-terminal region of Mouse Eif4b. Synthetic peptide located within the following region: DGGSRDHWKDLDRKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSV |
EIF4B rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human EIF4B |
EIF4B Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 352-611 of human EIF4B (NP_001408.2). |
| Modifications | Unmodified |
Phospho-EIF4B-S422 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around S422 of human EIF4B (NP_001408.2). |
| Modifications | Phospho S422 |
Active filters
Target Symbol
- EIF4B