Antibodies

Jump to Filters
View as table Download
ENGASE (Center) Rabbit Polyclonal Antibody
AP51428PU-N

USD 450.00

2 Weeks

ENGASE (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 326-354 amino acids from the Central region of Human ENASE
ENGASE Rabbit Polyclonal Antibody
TA338329

USD 375.00

5 Days

Rabbit Polyclonal Anti-ENGASE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ENGASE antibody is: synthetic peptide directed towards the N-terminal region of Human ENGASE. Synthetic peptide located within the following region: RRRQLQGLAAPEAGTQEEQEDQEPRPRRRRPGRSIKDEEEETVFREVVSF