ERAS rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ERAS |
ERAS rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ERAS |
Rabbit polyclonal ERAS Antibody (N-term) (F66)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ERAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 51-81 amino acids from the N-terminal region of human ERAS. |
Rabbit polyclonal anti-ERAS antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ERAS. |
ERAS rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-Eras Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Eras Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LPTKSSILDLSSGTPCTRSPEESHEAWAQCKDAGRQLPEYKAVVVGASGV |
Rabbit Polyclonal Anti-ERAS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ERAS Antibody: synthetic peptide directed towards the middle region of human ERAS. Synthetic peptide located within the following region: AQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAF |
Carrier-free (BSA/glycerol-free) ERAS mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ERAS mouse monoclonal antibody, clone OTI3A3 (formerly 3A3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ERAS Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ERAS |
ERAS mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ERAS mouse monoclonal antibody, clone OTI2C6 (formerly 2C6), Biotinylated
Applications | IF, WB |
Reactivities | Human |
Conjugation | Biotin |
ERAS mouse monoclonal antibody, clone OTI2C6 (formerly 2C6), HRP conjugated
Applications | IF, WB |
Reactivities | Human |
Conjugation | HRP |
ERAS mouse monoclonal antibody, clone OTI2C6 (formerly 2C6)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ERAS mouse monoclonal antibody, clone OTI3A3 (formerly 3A3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
ERAS mouse monoclonal antibody,clone 3A3, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
ERAS mouse monoclonal antibody,clone 3A3, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
ERAS mouse monoclonal antibody, clone OTI3A3 (formerly 3A3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |