Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-THEX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-THEX1 antibody: synthetic peptide directed towards the N terminal of human THEX1. Synthetic peptide located within the following region: EPPRPSPEETQQCKFDGQETKGSKFITSSASDFSDPVYKEIAITNGCINR |
Rabbit Polyclonal Anti-THEX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-THEX1 antibody: synthetic peptide directed towards the C terminal of human THEX1. Synthetic peptide located within the following region: GSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTIM |
Rabbit polyclonal anti-ERI1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ERI1. |
HEXO (ERI1) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 79-109 amino acids from the N-terminal region of Human ERI1 |
Rabbit anti-ERI1 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human THEX1. |
ERI1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ERI1 |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- ERI1