Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-RBM35A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBM35A antibody: synthetic peptide directed towards the N terminal of human RBM35A. Synthetic peptide located within the following region: MTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKF |
Mouse monoclonal Esrp-1 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
ESRP1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ESRP1 |
ESRP1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human ESRP1 (NP_060167.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ESRP1