Antibodies

View as table Download

ETFA (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 283-311 amino acids from the C-terminal region of human ETFA

ETFA (C-term) goat polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Bovine, Canine, Human, Mouse, Rat
Immunogen Peptide with sequence from the C Terminus of the protein sequence according to NP_000117.1 and NP_001121188.1.

Goat Anti-ETFA (aa139-152) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-KSPDTFVRTIYAGN, from the internal region of the protein sequence according to NP_000117.1; NP_001121188.1.

Rabbit Polyclonal Anti-ETFA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ETFA Antibody: synthetic peptide directed towards the N terminal of human ETFA. Synthetic peptide located within the following region: FRAAAPGQLRRAASLLRFQSTLVIAEHANDSLAPITLNTITAATRLGGEV

Rabbit Polyclonal Anti-ETFA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ETFA Antibody: synthetic peptide directed towards the middle region of human ETFA. Synthetic peptide located within the following region: VVSGGRGLKSGENFKLLYDLADQLHAAVGASRAAVDAGFVPNDMQVGQTG

Carrier-free (BSA/glycerol-free) ETFA mouse monoclonal antibody, clone OTI5C4 (formerly 5C4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ETFA Antibody - middle region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse ETFA

ETFA Rabbit polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-333 of human ETFA (NP_000117.1).
Modifications Unmodified

ETFA mouse monoclonal antibody, clone OTI5C4 (formerly 5C4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated