Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-EVX1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EVX1 antibody: synthetic peptide directed towards the middle region of human EVX1. Synthetic peptide located within the following region: GSGSEALVGSPNGGSETPKSNGGSGGGGSQGTLACSASDQMRRYRTAFTR |
Rabbit Polyclonal Anti-EVX1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EVX1 antibody: synthetic peptide directed towards the N terminal of human EVX1. Synthetic peptide located within the following region: PEPPEKMVPRGCLSPRAVPPATRERGGGGPEEEPVDGLAGSAAGPGAEPQ |
Rabbit Polyclonal Anti-EVX1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EVX1 antibody: synthetic peptide directed towards the N terminal of human EVX1. Synthetic peptide located within the following region: AGSAAGPGAEPQVAGAAMLGPGPPAPSVDSLSGQGQPSSSDTESDFYEEI |
Carrier-free (BSA/glycerol-free) EVX1 mouse monoclonal antibody,clone OTI1F8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EVX1 mouse monoclonal antibody,clone OTI1A9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EVX1 mouse monoclonal antibody,clone OTI1F4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
EVX1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human EVX1 |
EVX1 mouse monoclonal antibody,clone OTI1F8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
EVX1 mouse monoclonal antibody,clone OTI1F8, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
EVX1 mouse monoclonal antibody,clone OTI1F8, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
EVX1 mouse monoclonal antibody,clone OTI1F8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
EVX1 mouse monoclonal antibody,clone OTI1A9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
EVX1 mouse monoclonal antibody,clone OTI1A9, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
EVX1 mouse monoclonal antibody,clone OTI1A9, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
EVX1 mouse monoclonal antibody,clone OTI1A9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
EVX1 mouse monoclonal antibody,clone OTI1F4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
EVX1 mouse monoclonal antibody,clone OTI1F4, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
EVX1 mouse monoclonal antibody,clone OTI1F4, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
EVX1 mouse monoclonal antibody,clone OTI1F4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- EVX1