EXD2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human EXD2 |
EXD2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human EXD2 |
Rabbit Polyclonal Anti-EXD2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-EXD2 Antibody is: synthetic peptide directed towards the N-terminal region of Human EXD2. Synthetic peptide located within the following region: SNWDAETLTEDQVIYAARDAQISVALFLHLLGYPFSRNSPGEKNDDHSSW |
Rabbit Polyclonal Anti-EXD2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-EXD2 Antibody is: synthetic peptide directed towards the middle region of Human EXD2. Synthetic peptide located within the following region: NGEATESQQKPRNKKSKMDGMVPGNHQGRDPRKHKRKPLGVGYSARKSPL |
EXD2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle terminal region of human EXD2 |
EXD2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human EXD2 |
EXD2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human EXD2 |