Antibodies

Jump to Filters
View as table Download
FEZ2 (C-term) Rabbit Polyclonal Antibody
AP22606PU-N

USD 525.00

2 Weeks

FEZ2 (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen FEZ2 antibody was raised against 15 amino acid peptide from near the carboxy terminus of human FEZ2
FEZ2 Rabbit Polyclonal Antibody
TA306503

USD 430.00

5 Days

Rabbit Polyclonal FEZ2 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen FEZ2 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human FEZ2.
FEZ2 Rabbit Polyclonal Antibody
TA306504

USD 430.00

5 Days

Rabbit Polyclonal FEZ2 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen FEZ2 antibody was raised against a 15 amino acid peptide from near the center of human FEZ2.
FEZ2 Rabbit Polyclonal Antibody
TA333948

USD 375.00

5 Days

Rabbit Polyclonal Anti-FEZ2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FEZ2 Antibody is: synthetic peptide directed towards the C-terminal region of Human FEZ2. Synthetic peptide located within the following region: IEVQNKQKEHKETAKKKKKLKNGSSQNGKNERSHMPGTYLTTVIPYEKKN
Fez2 Rabbit Polyclonal Antibody
TA358962

USD 360.00

5 Days

FEZ2 Antibody - C-terminal

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Rat FEZ2