FEZ2 Rabbit Polyclonal Antibody

CAT#: TA333948

Rabbit Polyclonal Anti-FEZ2 Antibody

Product Images

WB Suggested Anti-FEZ2 Antibody; Titration: 1.0 ug/ml; Positive Control: Hela Whole cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FEZ2 Antibody is: synthetic peptide directed towards the C-terminal region of Human FEZ2. Synthetic peptide located within the following region: IEVQNKQKEHKETAKKKKKLKNGSSQNGKNERSHMPGTYLTTVIPYEKKN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: fasciculation and elongation protein zeta 2
• Database Link:
  NP_005093
  Entrez Gene 9637 Human
  UniProt ID Q9UHY8
• Background: This gene is an ortholog of the C. elegans unc-76 gene, which is necessary for normal axonal bundling and elongation within axon bundles. Other orthologs include the rat gene that encodes zygin II, which can bind to synaptotagmin.
• Synonyms: HUM3CL
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 92%; Horse: 86%; Mouse: 79%