Antibodies

Jump to Filters
View as table Download
FGL1 Rabbit Polyclonal Antibody
TA349318

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-FGL1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FGL1
FGL1 (C-term) Rabbit Polyclonal Antibody
AP51664PU-N

USD 450.00

2 Weeks

FGL1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide from the C-terminal region ( between 225-256 aa) of human FGL1.
FGL1 Goat Polyclonal Antibody
TA311300

USD 375.00

5 Days

Goat Anti-FGL1 / Hepassocin Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-ETRVKQQQVKIKQ, from the internal region of the protein sequence according to NP_004458.3.
FGL1 Rabbit Polyclonal Antibody
TA338186

USD 375.00

5 Days

Rabbit Polyclonal Anti-FGL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FGL1 antibody: synthetic peptide directed towards the middle region of human FGL1. Synthetic peptide located within the following region: EFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWL
FGL1 Rabbit Polyclonal Antibody
TA368807

USD 380.00

4 Weeks

FGL1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FGL1
FGL1 Rabbit Polyclonal Antibody
TA384228

USD 380.00

4 Weeks

FGL1 Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthesized peptide derived from the Internal region of human Hepassocin.