Rabbit polyclonal Anti-Fam172a Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Fam172a antibody: synthetic peptide directed towards the n terminal of mouse 1110033M05Rik. Synthetic peptide located within the following region: NLVGARILREKVRARAQGSSPRDLEGHASSHLPSQHCSWGQSSDLLSRID |
Rabbit Polyclonal Anti-FAM172A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FAM172A Antibody is: synthetic peptide directed towards the middle region of Human FAM172A. Synthetic peptide located within the following region: SSDSSDEPAEKRERKDKVSKETKKRRDFYEKYRNPQREKEMMQLYIRENG |
Germany
Japan
United Kingdom
China