Germany
Japan
United Kingdom
China
Fam172a Rabbit Polyclonal Antibody
Product Images
Other products for "Fam172a"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Mouse |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-Fam172a antibody: synthetic peptide directed towards the n terminal of mouse 1110033M05Rik. Synthetic peptide located within the following region: NLVGARILREKVRARAQGSSPRDLEGHASSHLPSQHCSWGQSSDLLSRID |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 46 kDa |
| Gene Name | family with sequence similarity 172, member A |
| Database Link | |
| Background | The amino acid sequence of 1110033M05Rik is derived from an annotated genomic sequence (NT_039589) using gene prediction method: GNOMON, supported by mRNA and EST evidence. |
| Synonyms | C5orf21; DKFZP564D172 |
| Note | Mouse: 100% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.