Germany
Japan
United Kingdom
China
FGB Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FGB |
Antibodies
View as table Download
Anti-FGB Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 290 amino acids of human fibrinogen beta chain |
Rabbit Polyclonal Anti-FGB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FGB antibody is: synthetic peptide directed towards the middle region of Human FGB. Synthetic peptide located within the following region: GNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNK |
USD 440.00
2 Weeks
Rabbit polyclonal anti-Fibrinogen beta chain antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human FIBB. |
FGB Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | internal region (EKHQLYIDETVNSN) |
Fibrinogen beta chain (FGB) (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human FIBB |
Fibrinogen beta chain (FGB) (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human FIBB |
FGB Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | internal region (RSKIQKLESDVSAQ) |
USD 523.00
2 Weeks
Recombinant Anti-Fibrin beta-chain (Clone 8E5)
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 523.00
2 Weeks
Recombinant Anti-Fibrin beta-chain (Clone 8E5)
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Active filters
Target Symbol
- FGB