Frizzled 2 (FZD2) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_001457.1. |
Frizzled 2 (FZD2) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_001457.1. |
Rabbit polyclonal anti-FZD2 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD2. |
Rabbit Polyclonal Anti-FZD2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FZD2 antibody: synthetic peptide directed towards the N terminal of human FZD2. Synthetic peptide located within the following region: MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDI |
Frizzled 2 (FZD2) goat polyclonal antibody, Purified
Applications | ELISA, IHC |
Reactivities | Bovine, Canine, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rat |
Immunogen | Synthetic peptide from the internal region of the human protein sequence according to NP_001457.1 |
Anti-FZD2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 188-200 amino acids of human frizzled family receptor 2 |
Frizzled 2 (FZD2) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 533-563 amino acids from the C-terminal region of Human FZD2 / Frizzled-2 |
Rabbit Polyclonal Anti-FZD2 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | FSD2 / Frizzled 2 antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human Frizzled 2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Horse, Rabbit, Pig, Platypus (100%); Opossum (95%); Turkey, Lizard, Newt (80%). |
Anti-FZD2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 188-190 amino acids of human led family receptor 2 |