Rabbit Polyclonal Anti-G6PC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC3 antibody is: synthetic peptide directed towards the N-terminal region of Human G6PC3. Synthetic peptide located within the following region: ESGYYSQAPAQVHQFPSSCETGPGSPSGHCMITGAALWPIMTALSSQVAT |
Rabbit Polyclonal Anti-G6pc3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6pc3 antibody is: synthetic peptide directed towards the middle region of Mouse G6pc3. Synthetic peptide located within the following region: PEWVHMDSRPFASLSRDSGSALGLGIALHTPCYAQIRRAHLGNGQKIAC |
G6PC3 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human G6PC3 (NP_612396.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
