G6PC3 Rabbit Polyclonal Antibody

CAT#: TA337919

Rabbit Polyclonal Anti-G6PC3 Antibody

Product Images

Host: Rabbit; Target Name: G6PC3; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: G6PC3; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: G6PC3; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: G6PC3; Sample Tissue: Hela; Antibody Dilution: 1.0 ug/ml G6PC3 is strongly supported by BioGPS gene expression data to be expressed in HeLa

• 

  WB Suggested Anti-G6PC3 Antibody; Titration: 1.0 ug/ml; Positive Control: 721_B Whole Cell G6PC3 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Show all 5 images

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-G6PC3 antibody is: synthetic peptide directed towards the N-terminal region of Human G6PC3. Synthetic peptide located within the following region: ESGYYSQAPAQVHQFPSSCETGPGSPSGHCMITGAALWPIMTALSSQVAT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: glucose-6-phosphatase catalytic subunit 3
• Database Link:
  NP_612396
  Entrez Gene 92579 Human
  UniProt ID Q9BUM1
• Background: This gene encodes the catalytic subunit of glucose-6-phosphatase (G6Pase). G6Pase is located in the endoplasmic reticulum (ER) and catalyzes the hydrolysis of glucose-6-phosphate to glucose and phosphate in the last step of the gluconeogenic and glycogenolytic pathways. Mutations in this gene result in autosomal recessive severe congenital neutropenia. Multiple transcript variants have been found for this gene, only one of which is expected to express a protein.
• Synonyms: SCN4; UGRP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%; Sheep: 85%

Reference Data

• Protein Families: Druggable Genome, Transmembrane