Germany
Japan
United Kingdom
China
Goat Polyclonal Antibody against Vitamin D-binding protein / GC
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CDNLSTKNSKFED, from the internal region of the protein sequence according to NP_000574.2. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-GC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GC antibody: synthetic peptide directed towards the N terminal of human GC. Synthetic peptide located within the following region: KHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLV |
USD 545.00
3 Days
Carrier-free (BSA/glycerol-free) GC mouse monoclonal antibody,clone OTI3H10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 545.00
3 Days
USD 545.00
3 Days
Carrier-free (BSA/glycerol-free) GC mouse monoclonal antibody,clone OTI8C5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-GC Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 217-474 amino acids of human group-specific component (vitamin D binding protein) |
GC Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 324-493 of human GC (NP_001191236.1). |
| Modifications | Unmodified |
USD 447.00
In Stock
GC mouse monoclonal antibody,clone OTI3H10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
GC mouse monoclonal antibody,clone OTI3H10, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
GC mouse monoclonal antibody,clone OTI3H10, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 159.00
2 Days
GC mouse monoclonal antibody,clone OTI3H10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 447.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
USD 447.00
In Stock
GC mouse monoclonal antibody,clone OTI8C5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
GC mouse monoclonal antibody,clone OTI8C5, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
GC mouse monoclonal antibody,clone OTI8C5, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 159.00
2 Days
GC mouse monoclonal antibody,clone OTI8C5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- GC