Germany
Japan
United Kingdom
China
Antibodies
View as table Download
GCLM mouse monoclonal antibody, clone AT2D12, Purified
| Applications | ELISA, FC, IF, WB |
| Reactivities | Human |
GCLM mouse monoclonal antibody, clone AT2D12, Purified
| Applications | ELISA, FC, IF, WB |
| Reactivities | Human |
Rabbit polyclonal GCLM Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This GCLM antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 246-274 amino acids from the C-terminal region of human GCLM. |
Rabbit Polyclonal Anti-GCLM Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GCLM antibody: synthetic peptide directed towards the middle region of human GCLM. Synthetic peptide located within the following region: KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ |
GCLM Antibody
| Applications | WB |
| Conjugation | Unconjugated |
GCLM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GCLM Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-274 of human GCLM (NP_002052.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- GCLM