Rabbit Polyclonal antibody to GAD67 (glutamate decarboxylase 1 (brain, 67kDa))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 5 and 216 of GAD67 (Uniprot ID#Q99259) |
GAD67 (GAD1) chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide KLH conjugated corresponding to a region near the C-terminus of this gene product, and was 100% conserved between the Human (Q99259), Mouse (P48318) and Rat (NP_058703) gene products. After repeated injections into the hens, immune eggs were collected, and the IgY fractions were purified from the yolks. These IgY fractions were then affinity purified using a peptide column. |
Rabbit Polyclonal Anti-GAD1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GAD1 Antibody: A synthesized peptide derived from human GAD1 |
Rabbit Polyclonal Anti-GAD1/2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GAD1/2 Antibody: A synthesized peptide derived from human GAD1/2 |
GAD67 (GAD1) (+ GAD2 / GAD65) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Feline, Human, Mouse, Rat |
| Immunogen | Synthetic peptide sequence from the C-terminus of GAD |
Rabbit Polyclonal Anti-Gad1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Gad1 Antibody: synthetic peptide directed towards the N terminal of human Gad1. Synthetic peptide located within the following region: TRKLGLKICGFLQRTNSLEEKSRLVSAFRERQSSKNLLSCENSDQGARFR |
GAD67 (GAD1) (+GAD25) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat |
| Immunogen | Peptide with sequence C-QRTNSLEEKSR, from the internal region of the protein sequence according to NP_038473.2; NP_000808.2. |
Goat Anti-GAD1 (isoform GAD67) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PDSPQRREKLHK, from the internal region of the protein sequence according to NP_000808.2. |
Rabbit anti-GAD1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human GAD1 |
Rabbit Polyclonal Anti-GAD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GAD1 Antibody: synthetic peptide directed towards the N terminal of human GAD1. Synthetic peptide located within the following region: MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGF |
Carrier-free (BSA/glycerol-free) GAD1 mouse monoclonal antibody, clone OTI3G9 (formerly 3G9)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GAD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GAD1 |
Rabbit Polyclonal Anti-GAD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GAD1 |
GAD67 Rabbit polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human GAD67 |
GAD1 (GAD67) mouse monoclonal antibody, clone OTI3H2 (formerly 3H2)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
GAD1 (GAD67) mouse monoclonal antibody, clone OTI3G9 (formerly 3G9)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Anti-GAD1 (GAD67) mouse monoclonal antibody, clone OTI5D8 (formerly 5D8)
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
