Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-GAPDHS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GAPDHS antibody: synthetic peptide directed towards the N terminal of human GAPDHS. Synthetic peptide located within the following region: PFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQI |
Rabbit Polyclonal Anti-GAPDHS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GAPDHS |
GAPDHS Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 179-408 of human GAPDHS (NP_055179.1). |
| Modifications | Unmodified |
USD 420.00
5 Days
Active filters
Target Symbol
- GAPDHS