Antibodies

View as table Download

Rabbit Polyclonal Anti-SIP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIP1 antibody: synthetic peptide directed towards the middle region of human SIP1. Synthetic peptide located within the following region: HSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS

Gemin 2 (GEMIN2) (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen SIP1 antibody was raised against synthetic peptide - KLH conjugated

Rabbit Polyclonal Anti-Sip1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Sip1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PRTPQEYLRRVQIEAAQCPDVVVAQIDPKKLKRKQSVNISLSGCQPAPEG

Rabbit Polyclonal SIP1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SIP1 antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human SIP1.

Carrier-free (BSA/glycerol-free) GEMIN2 mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GEMIN2 mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SIP1 mouse monoclonal antibody, clone OTI6G4 (formerly 6G4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SIP1 mouse monoclonal antibody, clone OTI4A2 (formerly 4A2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-GEMIN2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 264-280 amino acids of human gem (nuclear organelle) associated protein 2

Anti-GEMIN2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 264-280 amino acids of human gem (nuclear organelle) associated protein 2

Anti-GEMIN2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 264-280 amino acids of human gem (nuclear organelle) associated protein 2

Anti-GEMIN2 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 264-280 amino acids of human gem (nuclear organelle) associated protein 2

GEMIN2 mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GEMIN2 mouse monoclonal antibody, clone OTI4B3 (formerly 4B3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GEMIN2 mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GEMIN2 mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SIP1 mouse monoclonal antibody, clone OTI6G4 (formerly 6G4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SIP1 mouse monoclonal antibody, clone OTI6G4 (formerly 6G4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SIP1 mouse monoclonal antibody, clone OTI4A2 (formerly 4A2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SIP1 mouse monoclonal antibody, clone OTI4A2 (formerly 4A2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated