Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-GIPC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GIPC1 antibody: synthetic peptide directed towards the N terminal of human GIPC1. Synthetic peptide located within the following region: SGGPQMGLPPPPPALRPRLVFHTQLAHGSPTGRIEGFTNVKELYGKIAEA |
Goat Polyclonal Antibody against GIPC1 / NIP
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-GAIGDAKVGRY, from the C Terminus of the protein sequence according to NP_005707.1; NP_974197.1; NP_974199.1; NP_974196.1; NP_974198.1; NP_974223.1. |
GIPC1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human GIPC1 |
GIPC1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GIPC1 |
GIPC1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-333 of human GIPC1 (NP_005707.1). |
| Modifications | Unmodified |
GIPC1 mouse monoclonal antibody,clone OTI4C11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
GIPC1 mouse monoclonal antibody,clone OTI5C10
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
2 Weeks
USD 420.00
2 Weeks
USD 420.00
2 Weeks
USD 420.00
2 Weeks
Active filters
Target Symbol
- GIPC1