Antibodies

View as table Download

GRIK5 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GRIK5

Rabbit Polyclonal Grik5 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Grik5 antibody was raised against a 17 amino acid peptide near the carboxy terminus of the human Grik5.

GRIK5 (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen GRIK5 antibody was raised against 17 amino acid peptide near the carboxy terminus of the human Grik5

Rabbit polyclonal Anti-GRIK5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRIK5 antibody: synthetic peptide directed towards the middle region of human GRIK5. Synthetic peptide located within the following region: EDGLYGAPEPNGSWTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFM

Grik5 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated

GRIK5 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GRIK5

GRIK5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 350-420 of human GRIK5 (NP_002079.3).
Modifications Unmodified