Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Mouse Hax1a Monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Goat Anti-HAX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TRHEADSSPRGDPES, from the internal region of the protein sequence according to NP_006109.2; NP_001018238.1. |
Rabbit Polyclonal Hax1a Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Hax1a antibody was raised against a 15 amino acid peptide near the amino terminus of human Hax1a. |
Rabbit Polyclonal Hax1b Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Hax1b antibody was raised against a 10 amino acid peptide near the amino terminus of human Hax1b. |
Mouse Hax1a Monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Mouse Hax1a Monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-HAX1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HAX1 antibody: synthetic peptide directed towards the middle region of human HAX1. Synthetic peptide located within the following region: LPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQP |
Rabbit Polyclonal Anti-HAX1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HAX1 antibody: synthetic peptide directed towards the middle region of human HAX1. Synthetic peptide located within the following region: QPAPDWGSQRPFHRFDDVWPMDPHPRTREDNDLDSQVSQEGLGPVLQPQP |
Active filters
Target Symbol
- HAX1