Rabbit polyclonal HEYL Antibody (N-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HEYL antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 26-54 amino acids from the N-terminal region of human HEYL. |
Rabbit Polyclonal anti-HEYL antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HEYL antibody: synthetic peptide directed towards the N terminal of human HEYL. Synthetic peptide located within the following region: MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKRRGI |
Carrier-free (BSA/glycerol-free) HEYL mouse monoclonal antibody,clone OTI4D8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
HEYL Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 129-328 of human HEYL (NP_055386.1). |
HEYL mouse monoclonal antibody,clone OTI4D8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
HEYL mouse monoclonal antibody,clone OTI4D8, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
HEYL mouse monoclonal antibody,clone OTI4D8, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
HEYL mouse monoclonal antibody,clone OTI4D8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
