Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-HLX Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLX antibody: synthetic peptide directed towards the middle region of human HLX. Synthetic peptide located within the following region: WFQNRRMKWRHSKEAQAQKDKDKEAGEKPSGGAPAADGEQDERSPSRSEG |
Rabbit Polyclonal Anti-HLX Antibody
| Applications | IF, WB |
| Reactivities | Human, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLX1 antibody: synthetic peptide directed towards the middle region of human HLX1 (Cat# AAP31195). Synthetic peptide located within the following region: PGPYAVLTKDTMPQTYKRKRSWSRAVFSNLQRKGLEKRFEIQKYVTKPDR |
HLX Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human HLX |
HLX Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 80-280 of human HLX (NP_068777.1). |
| Modifications | Unmodified |
HLX Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 80-280 of human HLX (NP_068777.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- HLX