Rabbit Polyclonal Anti-HNRPD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPD antibody: synthetic peptide directed towards the C terminal of human HNRPD. Synthetic peptide located within the following region: YGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKP |
Rabbit Polyclonal Anti-HNRPD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPD antibody: synthetic peptide directed towards the N terminal of human HNRPD. Synthetic peptide located within the following region: AESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTK |
Rabbit polyclonal hnRPD (Ab-83) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human hnRPD around the phosphorylation site of serine 83 (N-S-SP-P-R) |
Rabbit anti-HNRNPD Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HNRNPD |
Rabbit polyclonal hnRPD (Ser83) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human hnRPD around the phosphorylation site of serine 83 (N-S-SP-P-R). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-hnRPD Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-hnRPD Antibody: A synthesized peptide derived from human hnRPD |
Rabbit Polyclonal Anti-hnRPD Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-hnRPD Antibody: A synthesized peptide derived from human hnRPD |
Rabbit Polyclonal Anti-Phospho-hnRPD(Ser83) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-hnRPD(Ser83) Antibody: A synthesized peptide derived from human hnRPD around the phosphorylation site of Sersine 83 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-hnRPD (Phospho-Ser83) Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-hnRPD (Phospho-Ser83) Antibody: A synthesized peptide derived from human hnRPD (Phospho-Ser83) |
| Modifications | Phospho-specific |
Rabbit polyclonal HNRNPD Antibody (N-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HNRNPD antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 57-85 amino acids from the N-terminal region of human HNRNPD. |
HNRNPD Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human HNRPD |
HNRNPD Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-306 of human HNRNPD (NP_002129.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
