Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-HOXA1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HOXA1. |
Rabbit Polyclonal Anti-HOXA1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HOXA1 antibody: synthetic peptide directed towards the middle region of human HOXA1. Synthetic peptide located within the following region: NLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADPPRSLSLPRIGDIFSS |
Goat Anti-HOXA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QPATYQTSGN, from the internal region of the protein sequence according to NP_005513.1; NP_705873.2. |
Rabbit Polyclonal Anti-Hoxa1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Hoxa1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Hoxa1. Synthetic peptide located within the following region: KYLTRARSEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPMSPATPPG |
Rabbit Polyclonal Anti-Hoxa1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Hoxa1 antibody: synthetic peptide directed towards the c terminal of mouse Hoxa1. Synthetic peptide located within the following region: ETQVKIWFQNRRMKQKKREKEGLLPISPATPPGSDEKTEESSEKSSPSPS |
HOXA1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HOXA1 |
HOXA1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HOXA1 |
HOXA1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 75-205 of human HOXA1 (NP_005513.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- HOXA1