Rabbit Polyclonal Anti-HSPBAP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPBAP1 antibody: synthetic peptide directed towards the C terminal of human HSPBAP1. Synthetic peptide located within the following region: SDGKDFVDKDGEHFGKLHCAKRQQIMSNSENAIEEQIASNTTTTPQTFIS |
Rabbit Polyclonal Anti-HSPBAP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPBAP1 antibody: synthetic peptide directed towards the N terminal of human HSPBAP1. Synthetic peptide located within the following region: AAGSEATTPVIVAAGAGGEEGEHVKPFKPEKAKEIIMSLQQPAIFCNMVF |
Rabbit polyclonal anti-HBAP1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HBAP1. |
Rabbit Polyclonal Anti-HSPBAP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HSPBAP1 Antibody: synthetic peptide directed towards the middle region of human HSPBAP1. Synthetic peptide located within the following region: GCNLVFQVQGRKRWHLFPPEDTPFLYPTRIPYEESSVFSKINVVNPDLKR |
Germany
Japan
United Kingdom
China
