Antibodies

Jump to Filters
View as table Download
IGSF1 Rabbit Polyclonal Antibody
TA346293

USD 410.00

5 Days

Rabbit Polyclonal Anti-IGSF1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IGSF1 antibody: synthetic peptide directed towards the N terminal of human IGSF1. Synthetic peptide located within the following region: LCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNLTPEDEGVYICR
IGSF1 Rabbit Polyclonal Antibody
TA346294

USD 475.00

5 Days

Rabbit Polyclonal Anti-IGSF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IGSF1 antibody: synthetic peptide directed towards the N terminal of human IGSF1. Synthetic peptide located within the following region: WLLARPSAVVQMGQNVSLRCRGPVDGVGLALYKKGEDKPLQFLDATSIDD
IGSF1 Rabbit Polyclonal Antibody
TA346295

USD 475.00

5 Days

Rabbit Polyclonal Anti-IGSF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IGSF1 antibody: synthetic peptide directed towards the middle region of human IGSF1. Synthetic peptide located within the following region: PRLRTRGSETDGRDQTIALEECNQEGEPGTPANSPSSTSQRISVELPVPI
IGSF1 (C-term) Rabbit Polyclonal Antibody
AP52175PU-N

USD 450.00

2 Weeks

IGSF1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 1273-1301 amino acids from the C-terminal region of human IGSF1
IGSF1 Rabbit Polyclonal Antibody
TA329526

USD 375.00

5 Days

Rabbit Polyclonal anti-IGSF1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IGSF1 antibody: synthetic peptide directed towards the middle region of human IGSF1. Synthetic peptide located within the following region: TMAIFSIDNLTPEDEGVYICRTHIQMLPTLWSEPSNPLKLVVAGGCGYGC