IGSF1 Rabbit Polyclonal Antibody

CAT#: TA346293

Rabbit Polyclonal Anti-IGSF1 Antibody

Product Images

WB Suggested Anti-IGSF1 Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysate.IGSF1 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Rabbit Anti-IGSF1 Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IGSF1 antibody: synthetic peptide directed towards the N terminal of human IGSF1. Synthetic peptide located within the following region: LCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNLTPEDEGVYICR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: immunoglobulin superfamily member 1
• Database Link:
  NP_991402
  Entrez Gene 3547 Human
  UniProt ID Q8N6C5
• Background: Members of the immunoglobulin (Ig) superfamily, which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.Members of the immunoglobulin (Ig) superfamily (see MIM 147100), which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior. [supplied by OMIM]
• Synonyms: CHTE; IGCD1; IGDC1; INHBP; p120; PGSF2
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%; Sheep: 93%; Rat: 86%

Reference Data

• Protein Families: Transmembrane