IGSF1 Rabbit Polyclonal Antibody

CAT#: TA329526

Rabbit Polyclonal anti-IGSF1 antibody

Product Images

WB Suggested Anti-IGSF1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: HepG2 cell lysateIGSF1 is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IGSF1 antibody: synthetic peptide directed towards the middle region of human IGSF1. Synthetic peptide located within the following region: TMAIFSIDNLTPEDEGVYICRTHIQMLPTLWSEPSNPLKLVVAGGCGYGC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: immunoglobulin superfamily member 1
• Database Link:
  NP_991402
  Entrez Gene 3547 Human
  UniProt ID Q8N6C5
• Background: This gene encodes a member of the immunoglobulin-like domain-containing superfamily. Proteins in this superfamily contain varying numbers of immunoglobulin-like domains and are thought to participate in the regulation of interactions between cells. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2010]
• Synonyms: CHTE; IGCD1; IGDC1; INHBP; p120; PGSF2
• Note: Immunogen sequence homology: Human: 100%; Pig: 86%; Mouse: 86%; Sheep: 86%; Rabbit: 86%; Guinea pig: 86%; Dog: 79%; Rat: 79%; Horse: 79%; Bovine: 79%

Reference Data

• Protein Families: Transmembrane