Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-Il17b Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Il17b antibody is: synthetic peptide directed towards the N-terminal region of Rat Il17b. Synthetic peptide located within the following region: LLAISIFLVPSQPRNTKGKRKGQGRPGPLAPGPHQVPLDLVSRVKPYARM |
IL17B rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Highly pure (> 98%) E.coli derived 36.6 kDa recombinant human IL-17B |
IL17B rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Highly pure (> 98%) E.coli derived 36.6 kDa recombinant human IL-17B |
Carrier-free (BSA/glycerol-free) IL17B mouse monoclonal antibody,clone OTI1F10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL17B mouse monoclonal antibody,clone OTI3F7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL17B mouse monoclonal antibody,clone OTI2A3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
IL17B rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human IL17B |
IL-17B Rabbit polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from human protein at AA range: 1-50 |
IL17B mouse monoclonal antibody,clone OTI1F10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
IL17B mouse monoclonal antibody,clone OTI1F10, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
IL17B mouse monoclonal antibody,clone OTI1F10, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
IL17B mouse monoclonal antibody,clone OTI1F10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
IL17B mouse monoclonal antibody,clone OTI3F7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
IL17B mouse monoclonal antibody,clone OTI3F7, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
IL17B mouse monoclonal antibody,clone OTI3F7, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
IL17B mouse monoclonal antibody,clone OTI3F7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
IL17B mouse monoclonal antibody,clone OTI2A3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
IL17B mouse monoclonal antibody,clone OTI2A3, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
IL17B mouse monoclonal antibody,clone OTI2A3, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
IL17B mouse monoclonal antibody,clone OTI2A3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- IL17B