Rabbit Polyclonal Anti-IDH3A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IDH3A antibody: synthetic peptide directed towards the N terminal of human IDH3A. Synthetic peptide located within the following region: MKIFDAAKAPIQWEERNVTAIQGPGGKWMIPSEAKESMDKNKMGLKGPLK |
Goat Polyclonal Anti-IDH3A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IDH3A Antibody: Peptide with sequence DFTEEICRRVKDLD, from the C Terminus of the protein sequence according to NP_005521.1. |
Rabbit Polyclonal Anti-IDH3A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IDH3A antibody: synthetic peptide directed towards the middle region of human IDH3A. Synthetic peptide located within the following region: RHMGLFDHAARIEAACFATIKDGKSLTKDLGGNAKCSDFTEEICRRVKDL |
IDH3A Antibody - middle region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse IDH3A |
IDH3A Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 28-366 of human IDH3A (NP_005521.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
