Germany
Japan
United Kingdom
China
USD 300.00
2 Weeks
IL13 receptor alpha 2 (IL13RA2) mouse monoclonal antibody, clone B-D13, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
Antibodies
View as table DownloadUSD 270.00
2 Weeks
IL13 receptor alpha 2 (IL13RA2) mouse monoclonal antibody, clone B-D13, Azide Free
| Applications | FC, IHC |
| Reactivities | Human |
USD 270.00
2 Weeks
IL13 receptor alpha 1 (IL13RA1) mouse monoclonal antibody, clone B-K19, Azide Free
| Applications | FN, IHC |
| Reactivities | Human |
Rabbit Polyclonal Anti-IL13RA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL13RA2 Antibody: synthetic peptide directed towards the middle region of human IL13RA2. Synthetic peptide located within the following region: GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP |
USD 280.00
2 Weeks
IL13 receptor alpha 1 (IL13RA1) mouse monoclonal antibody, clone B-K19, Biotin
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Biotin |
Rabbit Polyclonal Anti-IL13RA2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL13RA2 antibody: synthetic peptide directed towards the N terminal of human IL13RA2. Synthetic peptide located within the following region: DHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLL |
Anti-IL13RA2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 43-330 amino acids of human interleukin 13 receptor, alpha 2 |
IL13RA2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL13RA2. |
| Modifications | Unmodified |
IL13RA2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 27-343 of human IL13RA2 (NP_000631.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- IL13RA2