Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Anti-Il1f5 Antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | The immunogen for anti-Il1f5 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LGTKESKSFTFYRRDLGLTSSFESAAYPGWFLCTSPEADQPVRLTQISED |
Rabbit polyclonal Anti-IL1F5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL1F5 antibody: synthetic peptide directed towards the middle region of human IL1F5. Synthetic peptide located within the following region: LTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD |
IL36RN rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human IL36RN |
IL36RN rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human IL36RN |
IL36RN Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-155 of human IL36RN (NP_036407.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- IL36RN