Il36rn Rabbit Polyclonal Antibody

CAT#: TA330955

Rabbit polyclonal Anti-Il1f5 Antibody

Product Images

WB Suggested Anti-Il1f5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Rat Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Il1f5 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LGTKESKSFTFYRRDLGLTSSFESAAYPGWFLCTSPEADQPVRLTQISED
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 17 kDa
• Gene Name: interleukin 36 receptor antagonist
• Database Link:
  NP_001101284
  Entrez Gene 311783 Rat
• Background: The function of Il1f5 remains unknown.
• Synonyms: Il1f5
• Note: Dog: 100%; Human: 100%; Mouse: 100%; Rat: 93%; Horse: 93%; Rabbit: 92%; Pig: 77%; Guinea pig: 77%