Germany
Japan
United Kingdom
China
SNF5 (SMARCB1) mouse monoclonal antibody, clone 25, Supernatant
| Applications | IHC |
| Reactivities | Human |
Antibodies
View as table Download
Inhibin alpha (INHA) mouse monoclonal antibody, clone R1, Supernatant
| Applications | IHC |
| Reactivities | Bovine, Human |
Inhibin alpha (INHA) rabbit polyclonal antibody, Purified
| Applications | IHC |
| Reactivities | Human |
| Immunogen | Synthetic peptide corresponding to human inhibin alpha |
Rabbit Polyclonal Anti-INHA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-INHA Antibody: synthetic peptide directed towards the N terminal of human INHA. Synthetic peptide located within the following region: GLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEP |
Rabbit polyclonal anti Inhibin a-Subunit (1-32) (hu); purified rabbit IgG
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Ser-Thr-Pro-Leu-Met-Ser-Trp-Pro-Trp-Ser-Pro-Ser- Ala-Leu-Arg-Leu-Leu-Gln-Arg-Pro-Pro-Glu-Glu-Pro-Ala-Ala-His-Ala-Asn- Cys-His-Arg-OH coupled to a carrier protein. |
Rabbit polyclonal anti Inhibin a-Subunit (1-32) (hu); neat antiserum
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Ser-Thr-Pro-Leu-Met-Ser-Trp-Pro-Trp-Ser-Pro-Ser- Ala-Leu-Arg-Leu-Leu-Gln-Arg-Pro-Pro-Glu-Glu-Pro-Ala-Ala-His-Ala-Asn- Cys-His-Arg-OH coupled to carrier protein. |
Rabbit polyclonal anti Inhibin a-Subunit (1-32) (po); neat antiserum
| Applications | ELISA |
| Reactivities | Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Ser-Thr-Ala-Pro-Leu-Pro-Trp-Pro-Trp-Ser-Pro-Ala- Ala-Leu-Arg-Leu-Leu-Gln-Arg-Pro-Pro-Glu-Glu-Pro-Ala-Val-His-Ala-Asp- Cys-His-Arg-OH coupled to carrier protein. |
Rabbit polyclonal anti Inhibin a-Subunit (1-32) (po); purified rabbit IgG
| Applications | ELISA |
| Reactivities | Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Ser-Thr-Ala-Pro-Leu-Pro-Trp-Pro-Trp-Ser-Pro-Ala- Ala-Leu-Arg-Leu-Leu-Gln-Arg-Pro-Pro-Glu-Glu-Pro-Ala-Val-His-Ala-Asp- Cys-His-Arg-OH coupled to carrier protein. |
Carrier-free (BSA/glycerol-free) INHA mouse monoclonal antibody, clone OTI12F11 (formerly 12F11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-INHA Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 233-366 amino acids of human inhibin, alpha |
Mouse Monoclonal Inhibin, alpha Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
INHA Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-366 of human INHA (NP_002182.1). |
| Modifications | Unmodified |
INHA mouse monoclonal antibody, clone OTI12F11 (formerly 12F11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
5 Days
INHA mouse monoclonal antibody,clone 12F11, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
5 Days
INHA mouse monoclonal antibody,clone 12F11, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
INHA mouse monoclonal antibody, clone OTI12F11 (formerly 12F11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- INHA