Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-KEL Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KEL antibody is: synthetic peptide directed towards the N-terminal region of Human KEL. Synthetic peptide located within the following region: PCETSVCLDLRDHYLASGNTSVAPCTDFFSFACGRAKETNNSFQELATKN |
Carrier-free (BSA/glycerol-free) KEL mouse monoclonal antibody,clone OTI5E6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KEL mouse monoclonal antibody,clone OTI8E1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
KEL Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 70-310 of human KEL (NP_000411.1). |
| Modifications | Unmodified |
KEL mouse monoclonal antibody,clone OTI5E6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
KEL mouse monoclonal antibody,clone OTI5E6, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
KEL mouse monoclonal antibody,clone OTI5E6, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
KEL mouse monoclonal antibody,clone OTI5E6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
KEL mouse monoclonal antibody,clone OTI8E1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
KEL mouse monoclonal antibody,clone OTI8E1, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
KEL mouse monoclonal antibody,clone OTI8E1, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
KEL mouse monoclonal antibody,clone OTI8E1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- KEL