KEL (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 213-243 amino acids from the Central region of Human CD238 / KEL |
KEL (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 213-243 amino acids from the Central region of Human CD238 / KEL |
Rabbit Polyclonal Anti-KEL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KEL antibody is: synthetic peptide directed towards the N-terminal region of Human KEL. Synthetic peptide located within the following region: PCETSVCLDLRDHYLASGNTSVAPCTDFFSFACGRAKETNNSFQELATKN |
Carrier-free (BSA/glycerol-free) KEL mouse monoclonal antibody,clone OTI5E6
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KEL mouse monoclonal antibody,clone OTI8E1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-KEL Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human KEL |
KEL Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 70-310 of human KEL (NP_000411.1). |
Modifications | Unmodified |
KEL mouse monoclonal antibody,clone OTI5E6
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
KEL mouse monoclonal antibody,clone OTI5E6, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
KEL mouse monoclonal antibody,clone OTI5E6, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
KEL mouse monoclonal antibody,clone OTI5E6
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
KEL mouse monoclonal antibody,clone OTI8E1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
KEL mouse monoclonal antibody,clone OTI8E1, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
KEL mouse monoclonal antibody,clone OTI8E1, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
KEL mouse monoclonal antibody,clone OTI8E1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".