KEL Rabbit Polyclonal Antibody

CAT#: TA343284

Rabbit Polyclonal Anti-KEL Antibody

Product Images

Host: Rabbit; Target Name: KEL; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KEL antibody is: synthetic peptide directed towards the N-terminal region of Human KEL. Synthetic peptide located within the following region: PCETSVCLDLRDHYLASGNTSVAPCTDFFSFACGRAKETNNSFQELATKN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 82 kDa
• Gene Name: Kell blood group, metallo-endopeptidase
• Database Link:
  NP_000411
  Entrez Gene 3792 Human
  UniProt ID P23276
• Background: This gene encodes a type II transmembrane glycoprotein that is the highly polymorphic Kell blood group antigen. The Kell glycoprotein links via a single disulfide bond to the XK membrane protein that carries the Kx antigen. The encoded protein contains sequence and structural similarity to members of the neprilysin (M13) family of zinc endopeptidases.
• Synonyms: CD238; ECE3
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Protease, Transmembrane