Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against KPNA1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence TTPGKENFRLKSY-C, from the N Terminus of the protein sequence according to NP_002255.1. |
Anti-KPNA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to N terminal 300 amino acids of human karyopherin alpha 1 (importin alpha 5) |
Rabbit Polyclonal Anti-KPNA1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KPNA1 antibody: synthetic peptide directed towards the N terminal of human KPNA1. Synthetic peptide located within the following region: TTPGKENFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVA |
Rabbit Polyclonal Anti-KPNA1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KPNA1 antibody: synthetic peptide directed towards the N terminal of human KPNA1. Synthetic peptide located within the following region: NMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVIS |
KPNA1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human KPNA1 |
KPNA1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human KPNA1 (NP_002255.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- KPNA1