Antibodies

Jump to Filters
View as table Download
ANKRD15 (KANK1) Rabbit Polyclonal Antibody
TA319847

USD 430.00

5 Days

Rabbit Polyclonal KANK1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KANK1 antibody was raised against a 19 amino acid peptide near the amino terminus of human KANK1 .
ANKRD15 (KANK1) Rabbit Polyclonal Antibody
TA330933

USD 375.00

5 Days

Rabbit polyclonal Anti-KANK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KANK1 antibody is: synthetic peptide directed towards the C-terminal region of Human KANK1. Synthetic peptide located within the following region: STALSIALEAGHKDIAVLLYAHVNFAKAQSPGTPRLGRKTSPGPTHRGSF
ANKRD15 (KANK1) Rabbit Polyclonal Antibody
TA377678

USD 220.00

3 Weeks

KANK1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 900-1000 of human KANK1 (NP_055973.2).