Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Anti-K2P10.1 (TREK-2)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide TFRNYSLDEEKKEDETEKMC, corresponding to amino acid residues 475-494 of rat K2P10.1 . Intracellular, C-terminal domain. |
Rabbit Polyclonal Anti-KCNK10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNK10 antibody: synthetic peptide directed towards the C terminal of human KCNK10. Synthetic peptide located within the following region: EDVQKIYKTFRNYSLDEEKKEEETEKMCNSDNSSTAMLTDCIQQHAELEN |
Rabbit Polyclonal Anti-KCNK10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNK10 antibody: synthetic peptide directed towards the C terminal of human KCNK10. Synthetic peptide located within the following region: QGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEK |
Rabbit Polyclonal Anti-KCNK10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNK10 antibody: synthetic peptide directed towards the N terminal of human KCNK10. Synthetic peptide located within the following region: EKAEFLRDHVCVSPQELETLIQHALDADNAGVSPIGNSSNNSSHWDLGSA |
Rabbit Polyclonal Anti-KCNK10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNK10 antibody: synthetic peptide directed towards the N terminal of human KCNK10. Synthetic peptide located within the following region: VVAIFVVVVVYLVTGGLVFRALEQPFESSQKNTIALEKAEFLRDHVCVSP |
KCNK10 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human KCNK10 |
KCNK10 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 384-543 of human KCNK10 (NP_612191.1). |
| Modifications | Unmodified |
KCNK10 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 384-543 of human KCNK10 (NP_612191.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- KCNK10