Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-FBXL10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FBXL10 antibody: synthetic peptide directed towards the middle region of human FBXL10. Synthetic peptide located within the following region: LSFFKRCGNICHIDLRYCKQVTKEGCEQFIAEMSVSVQFGQVEEKLLQKL |
Goat Anti-FBXL10 / PCCX2 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-FGQVEEKLLQKLS, from the C Terminus of the protein sequence according to NP_115979.3. |
KDM2B rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human KDM2B |
KDM2B Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 600-700 of human KDM2B (XP_011537177.1). |
Active filters
Target Symbol
- KDM2B