Rabbit Polyclonal Anti-JMJD2D Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-JMJD2D antibody: synthetic peptide directed towards the C terminal of human JMJD2D. Synthetic peptide located within the following region: RAQELTLQTPAKRPLLAGTTCTASGPEPEPLPEDGALMDKPVPLSPGLQH |
Rabbit Polyclonal JMJD2D Antibody
| Applications | ChIP |
| Reactivities | Human, Primate |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to a C-terminal portion of the human protein (within residues 460-520). [Swiss-Prot# Q6B0I6] |
Rabbit Polyclonal Anti-JMJD2D Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-JMJD2D antibody: synthetic peptide directed towards the C terminal of human JMJD2D. Synthetic peptide located within the following region: SSTPGPSAQIIHPSNGRRGRGRPPQKLRAQELTLQTPAKRPLLAGTTCTA |
Germany
Japan
United Kingdom
China
